Rabbit anti-human TFPI-2 antibody 100 µg
Antibodies & Cytokines
Kaninchen anti-human TFPI-2 Antikörper 100 µg
| 204,75 € (EUR) | |
|
Polyklonales IgG Anti Human TFPI-2 wird aus Kaninchenserum isoliert. Das Kaninchen wurde mit rekombinatem FPI-2 aus Pflanzen immunisiert. Das entsprechende IgG wurde mittels Affinitärtschromatographie an Protein G gereinigt. Reinheit: >98%. Immunogen: GAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV. | Kaninchen anti-human TFPI-2 Antikörper 100 µg |
Dokumentation / Anleitung:
Kaninchen anti-human TFPI-2 Antikörper 100 µg
Produktnummer: RF0012
Applikation: ELISA: to detect Human TFPI-2 by indirect ELISA a dilution of at least 1/300 of this antibody is required. Western Blot: to detect human TFPI-2 by WB analysis this IgG can be used in a dilution of 1/500.
Quelle: Rabbit
Technische Daten: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.
Transport/Lagerung: shipped on blue-ice, store at -20°C
