Rabbit anti-human BMP-7 antibody 100 µg
Antibodies & Cytokines
Kaninchen anti-human BMP-7 Antikörper 100 µg
| 204,75 € (EUR) | |
|
Polyklonales IgG Anti Human BMP-7 wird aus Kaninchenserum isoliert. Das Kaninchen wurde mit rekombinatem BMP-7 aus Pflanzen immunisiert. Das entsprechende IgG wurde mittels Affinitärtschromatographie an Protein G gereinigt. Reinheit: >98%. Immunogen: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH. | Kaninchen anti-human BMP-7 Antikörper 100 µg |
Dokumentation / Anleitung:
Kaninchen anti-human BMP-7 Antikörper 100 µg
Produktnummer: RF0017
Applikation: Western Blot: to detect human BMP 7 by WB analysis this IgG can be used in a dilution of 1/500.
Quelle: Rabbit
Technische Daten: Provided as 0.2?m sterile filtered solution in phosphate buffered saline. Lyophilized.
Transport/Lagerung: shipped on blue-ice, store at -20°C
