rHu BMP-7 Active 5 µg
Antibodies & Cytokines
rHu BMP-7 Aktiv 5 µg
| 225,00 € (EUR) | |
|
The bone morphogenetic proteins are a family of secreted signaling molecules that can induce ectopic bone growth. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Bone morphogenetic protein 7 (BMP7), also known as osteogenic protein 1 (OP1), is a widely expressed TGFb superfamily member with important functions during embryogenesis, in the adult, and in disease (Chen et al., 2004, Kishigami and Mishina 2005). BMP7 plays a role in a variety of organ systems. It promotes new bone formation and nephron development (Sampath et al., 1992, Kazama et al., 2008), inhibits the branching of prostate epithelium (Grishina et al., 2005), and antagonizes epithelialmesenchymal transition (EMT) (Zeisberg et al., 2003, Yu et al., 2009).In pathological conditions, BMP7 inhibits tumor growth and metastasis (Buijs et al., 2007), ameliorates fibrotic damage in nephritis (Zeisberg et al., 2003), and promotes neuroregeneration following brain ischemia (Chou et al., 2006). It is produced by transient expression of BMP-7 in non-transgenic plants. Recombinant human BMP-7 contains a 6-His-tag at the N-terminal end and is purified by sequential chromatography (FPLC). It contains no animal–derived components or impurities. Sequence: HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH. | rHu BMP-7 Aktiv 5 µg |
Dokumentation / Anleitung:
rHu BMP-7 Aktiv 5 µg
Produktnummer: RF0027-5
Details / Spezifikationen:
rHu BMP-7 Aktiv 5 µg
Quelle: Nicotiana benthamiana
Technische Daten: Purity: >97% (FPLC), one band in SDS-PAGE; p.I.: 8.49; MW=16.5 kDa and 144 amino acids; Endotoxin: < 0.04 EU/mg protein (LAL method); molecular formula: C719H1103N215O214S10.
Transport/Lagerung: shipped at RT, stored at -20°C
Verwandte Begriffe: bmp-7, bmp7


