rHuLXR 25 µg
Antibodies & Cytokines
25 µg
| 390,00 € (EUR) | |
|
"Liver X Receptors (LXRs) are nuclear receptors that regulate the metabolism of cholesterol and bile acids. There are two subtypes of LXRs, LXR? and LXR?. The LXRs are ligand-dependent transcription factors that form permissive heterodimers with the retinoid X receptor (RXR). LXR- member of Nuclear Receptor Family is activated by certain oxysterol derivatives of cholesterol. They play an important role in cholesterol, lipid, and carbohydrate metabolism. LXR? is highly expressed in liver tissue. They respond to elevated cholesterol levels via transactivation of genes involved in sterol transport (ABCA1, ABCG1, ABCG5, and ABCG8), cholesterol efflux and high-density lipoprotein (HDL) metabolism, and sterol catabolism (CYP7A1). They also play a central role in regulating cellular lipid content through activation of SREBP-1c, which is the master regulator of de novo lipogenesis. LXRs were found to upregulate angiopoietin- like protein 3 (Angpf13), a member of the family of vascular endothelial growth factors that is also a key regulator of lipid metabolism. The livers X receptors are critical for the control of lipid homeostasis. LXRs serve as cholesterol sensors that regulate the expression of multiple genes involved in the efflux, transport, and excretion of cholesterol. Synthetic LXR agonists inhibit the development of atherosclerosis in murine models. These observations identify the LXR pathway as a potential target for therapeutic intervention in human cardiovascular disease. Amino acid sequence: HHHHHHSSGIEGRGRLIKHMTPGGSEAGSQGSGEGEGVQ LTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQ SRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRA GLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNV | 25 µg |
Dokumentation / Anleitung:
25 µg
Produktnummer: RF0019-25
Details / Spezifikationen:
25 µg
Applikation: postive controls, immunogens
Quelle: Nicotiana benthamiana
Technische Daten: Purity: >97% (FPLC); p.I.: 6.4; MW=31.9 kDa (aa 201-461); Endotoxin: < 0.04 EU/mg protein (LAL method); molecular formula: C1422H2249N409O415S8.
Transport/Lagerung: shipped at RT, stored at -20°C
Verwandte Begriffe: lxr lbd ligand binding domain


